Return to main results Retrieve Phyre Job Id

Job DescriptionP0AB71
Confidence23.32%DateThu Jan 5 11:14:46 GMT 2012
Rank335Aligned Residues31
% Identity29%Templatec3c00B_
PDB info PDB header:membrane protein, protein transportChain: B: PDB Molecule:escu; PDBTitle: crystal structural of the mutated g247t escu/spas c-terminal domain
Resolution1.41 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   51........60.........70.........80.........90.........100.....
Predicted Secondary structure 



















Query SS confidence 






















































Query Sequence  AKVKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPV
Query Conservation 
   





 
                       
           
    


Alig confidence 








........................





















Template Conservation      

 

........................


 
  
  
   
   



Template Sequence  GETPLPLVI. . . . . . . . . . . . . . . . . . . . . . . . ETGKDAKALQIIKLAELYDIPV
Template Known Secondary structure  TTSSS
........................TT


Template Predicted Secondary structure 





........................






Template SS confidence 






















































   275....280... ......290.........300.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions