Return to main results Retrieve Phyre Job Id

Job DescriptionP75892
Confidence0.89%DateThu Jan 5 12:15:42 GMT 2012
Rank63Aligned Residues35
% Identity11%Templatec2rddB_
PDB info PDB header:membrane protein/transport proteinChain: B: PDB Molecule:upf0092 membrane protein yajc; PDBTitle: x-ray crystal structure of acrb in complex with a novel2 transmembrane helix.
Resolution3.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   342.......350.........360.........370.........380......
Predicted Secondary structure 






Query SS confidence 












































Query Sequence  GALIHTIPAAVIGGASIVVFGLIAVAGARIWVQNRVDLSQNGNLI
Query Conservation        

  

 

 
     
   

             
   
Alig confidence 


















..........















Template Conservation 


  
   
    




.......... 






 


  

Template Sequence  SPMSLILMLVVFGLIFYFM. . . . . . . . . . ILRPQQKRTKEHKKLM
Template Known Secondary structure 


..........TTTGG
Template Predicted Secondary structure 

..........
Template SS confidence 












































   1920.........30....... ..40.........50...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions