Return to main results Retrieve Phyre Job Id

Job DescriptionP04993
Confidence96.86%DateThu Jan 5 10:58:32 GMT 2012
Rank285Aligned Residues37
% Identity24%Templatec1s3sA_
PDB info PDB header:protein bindingChain: A: PDB Molecule:transitional endoplasmic reticulum atpase (ter PDBTitle: crystal structure of aaa atpase p97/vcp nd1 in complex with2 p47 c
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   152.......160...... ...170.........180........
Predicted Secondary structure 


................





Query SS confidence 














. . . . . . . . . . . . . . . .





















Query Sequence  NWQKVAAAVALTRRI. . . . . . . . . . . . . . . . SVISGGPGTGKTTTVAKLLAAL
Query Conservation    
  

        ................ 

 
 






 
   
  
Alig confidence 














................





















Template Conservation     
  
   
  

         
       

 

 
 


 
   

   
Template Sequence  RKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANET
Template Known Secondary structure 
TT







STTSS
Template Predicted Secondary structure 














Template SS confidence 




















































   210.........220.........230.........240.........250.........260..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions