Return to main results Retrieve Phyre Job Id

Job DescriptionP0AF67
Confidence95.27%DateThu Jan 5 11:25:24 GMT 2012
Rank248Aligned Residues39
% Identity26%Templatec1bifA_
PDB info PDB header:bifunctional enzymeChain: A: PDB Molecule:6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase; PDBTitle: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase bifunctional2 enzyme complexed with atp-g-s and phosphate
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   30.........40.........50.........60.........70.........80...
Predicted Secondary structure 




















Query SS confidence 





















































Query Sequence  VIYLYGDLGAGKTTFSRGFLQALGHQGNVKSPTYTLVEPYTLDNLMVYHFDLYR
Query Conservation 

 
 
 







 


   

    
 



 

  
      
 
 



Alig confidence 


























...............











Template Conservation 















  
 
 
    ...............    

     
Template Sequence  LIVMVGLPARGKTYISKKLTRYLNFIG. . . . . . . . . . . . . . . VPTREFNVGQYR
Template Known Secondary structure 

TTSSTT...............

Template Predicted Secondary structure 









...............

Template SS confidence 





















































   40.........50.........60...... ...70........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions