Return to main results Retrieve Phyre Job Id

Job DescriptionP37047
Confidence24.83%DateThu Jan 5 11:54:38 GMT 2012
Rank229Aligned Residues30
% Identity17%Templatec2da4A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:hypothetical protein dkfzp686k21156; PDBTitle: solution structure of the homeobox domain of the2 hypothetical protein, dkfzp686k21156
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   324.....330..... ....340.........350...
Predicted Secondary structure 


.........



Query SS confidence 











. . . . . . . . .

















Query Sequence  RRTLAAWFRHNV. . . . . . . . . QPLATSKALFIHRNTLEY
Query Conservation 
 

  

    .........
   

  
 





 
Alig confidence 











.........

















Template Conservation 
  

  
         
  

   

  


    
  
Template Sequence  LATLKKYWDNGMTSLGSVCREKIEAVATELNVDCEIVRT
Template Known Secondary structure  TTTTT

ST

Template Predicted Secondary structure 











Template SS confidence 






































   20.........30.........40.........50........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions