Return to main results Retrieve Phyre Job Id

Job DescriptionP21693
Confidence95.09%DateWed Jan 25 15:20:42 GMT 2012
Rank191Aligned Residues44
% Identity16%Templated1sxjc2
SCOP infoP-loop containing nucleoside triphosphate hydrolases P-loop containing nucleoside triphosphate hydrolases Extended AAA-ATPase domain
Resolution2.85

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40. ........50.........60.
Predicted Secondary structure 
















..






Query SS confidence 







































. .



















Query Sequence  TAFSTLNVLPPAQLTNLNELGYLTMTPVQAAALPAILAGK. . DVRVQAKTGSGKTAAFGLGL
Query Conservation          
   
   
   
       
  

  
  
 .. 


 







      
Alig confidence 






.











...............




..



















Template Conservation      


.
       
   ...............
       


 

 
 


 

 


Template Sequence  ETLDEVY. GQNEVITTVRKF. . . . . . . . . . . . . . . VDEGKLPHLLFYGPPGTGKTSTIVALA
Template Known Secondary structure  SSGGG

.S
...............TT




SSSSS
Template Predicted Secondary structure 


.

...............










Template SS confidence 





























































   22...... .30.........40 .........50.........60.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions