Return to main results Retrieve Phyre Job Id

Job DescriptionP21693
Confidence91.97%DateWed Jan 25 15:20:42 GMT 2012
Rank306Aligned Residues44
% Identity32%Templatec1xxhB_
PDB info PDB header:transferaseChain: B: PDB Molecule:dna polymerase iii subunit gamma; PDBTitle: atpgs bound e. coli clamp loader complex
Resolution3.45 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40 .........50.........60.
Predicted Secondary structure 















...







Query SS confidence 






































. . .




















Query Sequence  TAFSTLNVLPPAQLTNLNELGYLTMTPVQAAALPAILAG. . . KDVRVQAKTGSGKTAAFGLGL
Query Conservation          
   
   
   
       
  

  
  
...  


 







      
Alig confidence 






.









...............





...




















Template Conservation         .
       
 ...............       
 
  
  

 
 

   
   
Template Sequence  QTFADVV. GQEHVLTALA. . . . . . . . . . . . . . . NGLSLGRIHHAYLFSGTRGVGKTSIARLLA
Template Known Secondary structure  SSGGG

.S
...............TT


S

STTSS
Template Predicted Secondary structure 


.

...............











Template SS confidence 






























































   13...... 20......... 30.........40.........50.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions