Return to main results Retrieve Phyre Job Id

Job DescriptionP21693
Confidence95.17%DateWed Jan 25 15:20:42 GMT 2012
Rank187Aligned Residues44
% Identity20%Templatec1sxjB_
PDB info PDB header:replicationChain: B: PDB Molecule:activator 1 37 kda subunit; PDBTitle: crystal structure of the eukaryotic clamp loader2 (replication factor c, rfc) bound to the dna sliding clamp3 (proliferating cell nuclear antigen, pcna)
Resolution2.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40. ........50.........60.
Predicted Secondary structure 
















..






Query SS confidence 







































. .



















Query Sequence  TAFSTLNVLPPAQLTNLNELGYLTMTPVQAAALPAILAGK. . DVRVQAKTGSGKTAAFGLGL
Query Conservation          
   
   
   
       
  

  
  
 .. 


 







      
Alig confidence 






.










...............





..



















Template Conservation       
 .
       
  ...............         


 

 
 





  

Template Sequence  QVLSDIV. GNKETIDRLQQ. . . . . . . . . . . . . . . IAKDGNMPHMIISGMPGIGKTTSVHCLA
Template Known Secondary structure  SSGGG

.S
T...............S





STTSS
Template Predicted Secondary structure 


.

...............










Template SS confidence 





























































   18.20.... .....30..... ....40.........50.........60...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions