Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8G9
Confidence11.67%DateThu Jan 5 11:07:49 GMT 2012
Rank27Aligned Residues43
% Identity33%Templatec2ehwD_
PDB info PDB header:structural genomics, unknown functionChain: D: PDB Molecule:hypothetical protein tthb059; PDBTitle: conserved hypothetical proteim (tthb059) from thermo thermophilus hb8
Resolution2.22 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   11........20.........30.........40.........50.........60........
Predicted Secondary structure 







Query SS confidence 

























































Query Sequence  FEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAEQRVQILLSDNE
Query Conservation 



   




  

 
 
 




 




  
   
   
  

 

  
     
Alig confidence 













..




.......







......















Template Conservation 
  


 


  
 ..


 
.......
 

 


......
   
  
  
     
Template Sequence  LREALLHLEERAAQ. . EPEEP. . . . . . . YWRGLLLA. . . . . . VEAXEGRLKALRAEAE
Template Known Secondary structure  ..
TT
.............
Template Predicted Secondary structure  ..



.............
Template SS confidence 

























































   57..60.........70 ..... ....80... ......90.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions