Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAZ4
Confidence96.70%DateThu Jan 5 11:14:11 GMT 2012
Rank348Aligned Residues53
% Identity17%Templatec3tqcB_
PDB info PDB header:transferaseChain: B: PDB Molecule:pantothenate kinase; PDBTitle: structure of the pantothenate kinase (coaa) from coxiella burnetii
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   23......30.........40...... ...50.........60.........70.....
Predicted Secondary structure 



.....................












Query SS confidence 























. . . . . . . . . . . . . . . . . . . . .




























Query Sequence  ENLAQYIGQQHLLAAGKPLPRAIE. . . . . . . . . . . . . . . . . . . . . AGHLHSMILWGPPGTGKTTLAEVIARYAN
Query Conservation    






  

     
   
 .....................     



 










 


  
 
Alig confidence 























.....................




























Template Conservation    


 
    
 

  

   
                       
 
 





 






 
  
   
 
Template Sequence  QGQIEIVSLKEVTEIYLPLSRLLSFYVTARQTLQQATYQFLGKPEPKVPYIIGIAGSVAVGKSTTSRVLKALLS
Template Known Secondary structure  TTT
TT







TTSST
Template Predicted Secondary structure 


















Template SS confidence 









































































   41........50.........60.........70.........80.........90.........100.........110....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions