Return to main results Retrieve Phyre Job Id

Job DescriptionP0AEX5
Confidence96.73%DateThu Jan 5 11:24:32 GMT 2012
Rank267Aligned Residues24
% Identity25%Templatec2ygrD_
PDB info PDB header:hydrolaseChain: D: PDB Molecule:uvrabc system protein a; PDBTitle: mycobacterium tuberculosis uvra
Resolution3.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10.........20.. .......30
Predicted Secondary structure 





.........
Query SS confidence 















. . . . . . . . .







Query Sequence  VIAVTGSSGAGTTTTS. . . . . . . . . LAFRKIFA
Query Conservation 





 






 
.........  
   

Alig confidence 















.........







Template Conservation   




 








 
 
     
 
 
   
Template Sequence  LIVFTGLSGSGKSSLAFDTIFAEGQRRYVESLS
Template Known Secondary structure 
STTSSTTTTTT
Template Predicted Secondary structure 








Template SS confidence 
































   27..30.........40.........50.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions