Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence21.51%DateThu Jan 5 12:22:54 GMT 2012
Rank183Aligned Residues31
% Identity26%Templated1vdca2
SCOP infoFAD/NAD(P)-binding domain FAD/NAD(P)-binding domain FAD/NAD-linked reductases, N-terminal and central domains
Resolution2.50

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   15....20.........30.........40.........50.........60.........70...
Predicted Secondary structure 
























Query SS confidence 


























































Query Sequence  TRQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNA
Query Conservation      
 


   

           
            

   


  
  

     
Alig confidence 









............................




















Template Conservation   

 





............................
  
 
 
  
   
  



Template Sequence  RNKPLAVIGG. . . . . . . . . . . . . . . . . . . . . . . . . . . . GDSAMEEANFLTKYGSKVYII
Template Known Secondary structure  TTS

............................STTTSS
Template Predicted Secondary structure 




............................


Template SS confidence 


























































   144.....150... ......160.........170....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions