Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence30.41%DateThu Jan 5 12:22:54 GMT 2012
Rank145Aligned Residues30
% Identity37%Templated1pj5a2
SCOP infoFAD/NAD(P)-binding domain FAD/NAD(P)-binding domain FAD-linked reductases, N-terminal domain
Resolution1.61

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   16...20.........30.........40.........50.........60......... 70...
Predicted Secondary structure 























.
Query SS confidence 





















































.



Query Sequence  RQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIE. AGNA
Query Conservation     
 


   

           
            

   


  
  

  .   
Alig confidence 








............................
















.



Template Conservation     





............................

 


 
  
   
   
 

Template Sequence  TPRIVIIGA. . . . . . . . . . . . . . . . . . . . . . . . . . . . GIVGTNLADELVTRGWNNITVL
Template Known Secondary structure 




............................STT


Template Predicted Secondary structure 




............................



Template SS confidence 


























































   4.....10.. .......20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions