Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence26.62%DateThu Jan 5 12:22:54 GMT 2012
Rank158Aligned Residues28
% Identity18%Templated1h6va1
SCOP infoFAD/NAD(P)-binding domain FAD/NAD(P)-binding domain FAD/NAD-linked reductases, N-terminal and central domains
Resolution3.0

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   18.20.........30.........40.........50.........60.........70...
Predicted Secondary structure 





















Query SS confidence 























































Query Sequence  SVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNA
Query Conservation   
 


   

           
            

   


  
  

     
Alig confidence 






............................




















Template Conservation 





 ............................




 

  

  
  
 

Template Sequence  DLIIIGG. . . . . . . . . . . . . . . . . . . . . . . . . . . . GSGGLAAAKEAAKFDKKVMVL
Template Known Secondary structure 

............................SGGG


Template Predicted Secondary structure 


............................



Template SS confidence 























































   14.....20 .........30.........40.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions