Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence20.42%DateThu Jan 5 12:22:54 GMT 2012
Rank187Aligned Residues32
% Identity38%Templated1gtea4
SCOP infoNucleotide-binding domain Nucleotide-binding domain N-terminal domain of adrenodoxin reductase-like
Resolution1.65

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   14.....20.........30.........40.........50.........60......... 70...
Predicted Secondary structure 

























.
Query SS confidence 























































.



Query Sequence  TTRQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIE. AGNA
Query Conservation       
 


   

           
            

   


  
  

  .   
Alig confidence 










............................
















.



Template Conservation      

 



............................
 


  
  
   
   
 
 
Template Sequence  AYSAKIALLGA. . . . . . . . . . . . . . . . . . . . . . . . . . . . GPASISCASFLARLGYSDITIF
Template Known Secondary structure  GGG



............................STT


Template Predicted Secondary structure 






............................




Template SS confidence 




























































   185....190..... ....200.........210.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions