Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence25.54%DateThu Jan 5 12:22:54 GMT 2012
Rank163Aligned Residues44
% Identity39%Templatec3vh1A_
PDB info PDB header:metal binding proteinChain: A: PDB Molecule:ubiquitin-like modifier-activating enzyme atg7; PDBTitle: crystal structure of saccharomyces cerevisiae atg7 (1-595)
Resolution3.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........ 10.........20.........30.........40.........50.........60..
Predicted Secondary structure 

..................





















Query SS confidence 








. . . . . . . . . . . . . . . . . .




















































Query Sequence  MSGARLHTL. . . . . . . . . . . . . . . . . . LPELTTRQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVA
Query Conservation           ..................         
 


   

           
            

   


  
Alig confidence 








..................






.






............................









Template Conservation 


  

  











  
 
 



   .






............................




 


 
Template Sequence  LDPLKIADQSVDLNLKLMKWRILPDLNLDIIKNT. KVLLLGA. . . . . . . . . . . . . . . . . . . . . . . . . . . . GTLGCYVSRA
Template Known Secondary structure 

TT

T
.

............................S
Template Predicted Secondary structure 











.

............................



Template SS confidence 















































































   292.......300.........310.........320..... ....330.. .......340..
 
   63......70...
Predicted Secondary structure 



Query SS confidence 










Query Sequence  LKRLGIEAGNA
Query Conservation 
  

     
Alig confidence 










Template Conservation 
   

  

 
Template Sequence  LIAWGVRKITF
Template Known Secondary structure  TTT

Template Predicted Secondary structure 



Template SS confidence 










   343......350...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions