Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence51.69%DateThu Jan 5 12:22:54 GMT 2012
Rank94Aligned Residues29
% Identity38%Templatec3v76A_
PDB info PDB header:flavoproteinChain: A: PDB Molecule:flavoprotein; PDBTitle: the crystal structure of a flavoprotein from sinorhizobium meliloti
Resolution2.51 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   17..20.........30.........40.........50.........60.........70...
Predicted Secondary structure 






















Query SS confidence 
























































Query Sequence  QSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNA
Query Conservation    
 


   

           
            

   


  
  

     
Alig confidence 







............................




















Template Conservation   






............................
 


 

  

  
  
 

Template Sequence  QDVVIIGA. . . . . . . . . . . . . . . . . . . . . . . . . . . . GAAGXXCAIEAGKRGRRVLVI
Template Known Secondary structure 



............................STT

Template Predicted Secondary structure 



............................




Template SS confidence 
























































   6...10... ......20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions