Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence25.24%DateThu Jan 5 12:22:54 GMT 2012
Rank165Aligned Residues35
% Identity29%Templatec3pvcA_
PDB info PDB header:oxidoreductase, transferaseChain: A: PDB Molecule:trna 5-methylaminomethyl-2-thiouridine biosynthesis PDBTitle: crystal structure of apo mnmc from yersinia pestis
Resolution2.31 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   11........20.........30.........40.........50.........60.........70...
Predicted Secondary structure 

























Query SS confidence 






























































Query Sequence  PELTTRQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNA
Query Conservation          
 


   

           
            

   


  
  

     
Alig confidence 













............................




















Template Conservation         






............................







  

 

  



Template Sequence  PAATRCDDIAIIGG. . . . . . . . . . . . . . . . . . . . . . . . . . . . GIVSALTALALQRRGAVVTLY
Template Known Secondary structure 


S

SS

............................STTT

Template Predicted Secondary structure 








............................



Template SS confidence 






























































   259260.........270.. .......280.........290...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions