Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence21.04%DateThu Jan 5 12:22:54 GMT 2012
Rank185Aligned Residues29
% Identity48%Templatec3nrnA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized protein pf1083; PDBTitle: crystal structure of pf1083 protein from pyrococcus furiosus,2 northeast structural genomics consortium target pfr223
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   17..20.........30.........40.........50.........60.........70...
Predicted Secondary structure 






















Query SS confidence 
























































Query Sequence  QSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNA
Query Conservation    
 


   

           
            

   


  
  

     
Alig confidence 







............................




















Template Conservation   






............................
 


  
  
   
  
 

Template Sequence  XRAVVVGA. . . . . . . . . . . . . . . . . . . . . . . . . . . . GLGGLLAGAFLARNGHEIIVL
Template Known Secondary structure 
S
............................STT
Template Predicted Secondary structure 


............................



Template SS confidence 
























































   1....... .10.........20.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions