Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence50.33%DateThu Jan 5 12:22:54 GMT 2012
Rank97Aligned Residues34
% Identity21%Templatec3nlcA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized protein vp0956; PDBTitle: crystal structure of the vp0956 protein from vibrio parahaemolyticus.2 northeast structural genomics consortium target vpr147
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   12.......20.........30.........40.........50.........60.........70...
Predicted Secondary structure 

























Query SS confidence 





























































Query Sequence  ELTTRQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNA
Query Conservation         
 


   

           
            

   


  
  

     
Alig confidence 












............................




















Template Conservation          




............................
 


 

  

  
  
 

Template Sequence  PENLTERPIVIGF. . . . . . . . . . . . . . . . . . . . . . . . . . . . GPCGLFAGLVLAQXGFNPIIV
Template Known Secondary structure 
TT






............................STT


Template Predicted Secondary structure 








............................




Template SS confidence 





























































   93......100..... ....110.........120......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions