Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence45.35%DateThu Jan 5 12:22:54 GMT 2012
Rank110Aligned Residues33
% Identity15%Templatec3lzxB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:ferredoxin--nadp reductase 2; PDBTitle: crystal structure of ferredoxin-nadp+ oxidoreductase from bacillus2 subtilis (form ii)
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   13..... .20.........30.........40.........50.........60.........70...
Predicted Secondary structure 




...




















Query SS confidence 





. . .






















































Query Sequence  LTTRQS. . . VMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNA
Query Conservation        ...
 


   

           
            

   


  
  

     
Alig confidence 





...





............................




















Template Conservation 
      







............................




 

  
   
  
 

Template Sequence  MREDTKVYDITIIGG. . . . . . . . . . . . . . . . . . . . . . . . . . . . GPVGLFTAFYGGMRQASVKII
Template Known Secondary structure 


............................STT

Template Predicted Secondary structure 






............................




Template SS confidence 































































   1........10..... ....20.........30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions