Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence42.19%DateThu Jan 5 12:22:54 GMT 2012
Rank118Aligned Residues34
% Identity24%Templatec3k5iB_
PDB info PDB header:lyaseChain: B: PDB Molecule:phosphoribosyl-aminoimidazole carboxylase; PDBTitle: crystal structure of n5-carboxyaminoimidazole synthase from2 aspergillus clavatus in complex with adp and 5-3 aminoimadazole ribonucleotide
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   13......20.........30.........40.........50.........60.........70....
Predicted Secondary structure 

























Query SS confidence 





























































Query Sequence  LTTRQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNAL
Query Conservation        
 


   

           
            

   


  
  

     
 
Alig confidence 











............................





















Template Conservation 
     




 ............................
     

 

   
  
    
Template Sequence  MWNSRKVGVLGG. . . . . . . . . . . . . . . . . . . . . . . . . . . . GQLGRMLVESANRLNIQVNVLD
Template Known Secondary structure 
TT
S


............................ST

Template Predicted Secondary structure 






............................




Template SS confidence 





























































   1........10.. .......20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions