Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence33.75%DateThu Jan 5 12:22:54 GMT 2012
Rank138Aligned Residues34
% Identity44%Templatec3gucB_
PDB info PDB header:transferaseChain: B: PDB Molecule:ubiquitin-like modifier-activating enzyme 5; PDBTitle: human ubiquitin-activating enzyme 5 in complex with amppnp
Resolution2.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   12.......20.........30.........40.........50.........60.........70...
Predicted Secondary structure 

























Query SS confidence 





























































Query Sequence  ELTTRQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNA
Query Conservation         
 


   

           
            

   


  
  

     
Alig confidence 












............................




















Template Conservation 


    




 ............................




 

  

  


 
 
Template Sequence  EKIRTFAVAIVGV. . . . . . . . . . . . . . . . . . . . . . . . . . . . GGVGSVTAEMLTRCGIGKLLL
Template Known Secondary structure 
GGGG


............................STTT
S
Template Predicted Secondary structure 






............................



Template SS confidence 





























































   6970.........80. ........90.........100..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions