Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence29.01%DateThu Jan 5 12:22:54 GMT 2012
Rank151Aligned Residues30
% Identity33%Templatec3gmbB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:2-methyl-3-hydroxypyridine-5-carboxylic acid PDBTitle: crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic2 acid oxygenase
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   16...20.........30.........40.........50.........60.........70...
Predicted Secondary structure 























Query SS confidence 

























































Query Sequence  RQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNA
Query Conservation     
 


   

           
            

   


  
  

     
Alig confidence 








............................




















Template Conservation   
 
 



............................
 


  
  

  
  
 
 
Template Sequence  TRRAEVAGG. . . . . . . . . . . . . . . . . . . . . . . . . . . . GFAGLTAAIALKQNGWDVRLH
Template Known Secondary structure 



............................STT
Template Predicted Secondary structure 



............................



Template SS confidence 

























































   11........ 20.........30.........40
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions