Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence61.40%DateThu Jan 5 12:22:54 GMT 2012
Rank83Aligned Residues45
% Identity22%Templatec3da1A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:glycerol-3-phosphate dehydrogenase; PDBTitle: x-ray structure of the glycerol-3-phosphate dehydrogenase2 from bacillus halodurans complexed with fad. northeast3 structural genomics consortium target bhr167.
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........60.........70...
Predicted Secondary structure 



























Query SS confidence 








































































Query Sequence  MSGARLHTLLPELTTRQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNA
Query Conservation                    
 


   

           
            

   


  
  

     
Alig confidence 























............................




















Template Conservation      
            






............................

 
   
  

  

 
 

Template Sequence  SAKKRDKCIGEXSEKQLDLLVIGG. . . . . . . . . . . . . . . . . . . . . . . . . . . . GITGAGIALDAQVRGIQTGLV
Template Known Secondary structure 
TT
TTS


............................STTT

Template Predicted Secondary structure 









............................



Template SS confidence 








































































   3......10.........20...... ...30.........40.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions