Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence21.64%DateThu Jan 5 12:22:54 GMT 2012
Rank181Aligned Residues28
% Identity46%Templatec3ctyA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:thioredoxin reductase; PDBTitle: crystal structure of t. acidophilum thioredoxin reductase
Resolution2.35 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   18.20.........30.........40.........50.........60.........70...
Predicted Secondary structure 





















Query SS confidence 























































Query Sequence  SVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNA
Query Conservation   
 


   

           
            

   


  
  

     
Alig confidence 






............................




















Template Conservation 






............................
 


 

  
   
  
 

Template Sequence  DVVIVGA. . . . . . . . . . . . . . . . . . . . . . . . . . . . GAAGFSAAVYAARSGFSVAIL
Template Known Secondary structure 

............................STT

Template Predicted Secondary structure 

............................



Template SS confidence 























































   18.20.... .....30.........40.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions