Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence22.35%DateThu Jan 5 12:22:54 GMT 2012
Rank179Aligned Residues31
% Identity16%Templatec3ab1B_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:ferredoxin--nadp reductase; PDBTitle: crystal structure of ferredoxin nadp+ oxidoreductase
Resolution2.39 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   15....20.........30.........40.........50.........60.........70...
Predicted Secondary structure 
























Query SS confidence 


























































Query Sequence  TRQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNA
Query Conservation      
 


   

           
            

   


  
  

     
Alig confidence 









............................




















Template Conservation 

 






............................
 


 

  
   
  
 

Template Sequence  DMRDLTIIGG. . . . . . . . . . . . . . . . . . . . . . . . . . . . GPTGIFAAFQCGMNNISCRII
Template Known Secondary structure 



............................STT

Template Predicted Secondary structure 




............................



Template SS confidence 


























































   13......20.. .......30.........40...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions