Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence41.64%DateThu Jan 5 12:22:54 GMT 2012
Rank120Aligned Residues40
% Identity20%Templatec2v6oA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:thioredoxin glutathione reductase; PDBTitle: structure of schistosoma mansoni thioredoxin-glutathione2 reductase (smtgr)
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   6...10.........20.........30.........40.........50.........60.........70...
Predicted Secondary structure 

























Query SS confidence 



































































Query Sequence  LHTLLPELTTRQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNA
Query Conservation               
 


   

           
            

   


  
  

     
Alig confidence 


















............................




















Template Conservation             







............................




 

  

  
  
 

Template Sequence  LAGIVNESKYDYDLIVIGG. . . . . . . . . . . . . . . . . . . . . . . . . . . . GSGGLAAGKEAAKYGAKTAVL
Template Known Secondary structure  T

SSS

............................STT

Template Predicted Secondary structure 














............................




Template SS confidence 



































































   97..100.........110..... ....120.........130......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions