Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence46.63%DateThu Jan 5 12:22:54 GMT 2012
Rank107Aligned Residues45
% Identity20%Templatec2rghA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:alpha-glycerophosphate oxidase; PDBTitle: structure of alpha-glycerophosphate oxidase from2 streptococcus sp.: a template for the mitochondrial alpha-3 glycerophosphate dehydrogenase
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........60.........70...
Predicted Secondary structure 



























Query SS confidence 








































































Query Sequence  MSGARLHTLLPELTTRQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNA
Query Conservation                    
 


   

           
            

   


  
  

     
Alig confidence 























............................




















Template Conservation      
           







............................

 


 
  

  
  
 

Template Sequence  SNKTRQDSIQKXQQEELDLLIIGG. . . . . . . . . . . . . . . . . . . . . . . . . . . . GITGAGVAVQAAASGIKTGLI
Template Known Secondary structure  SS
BS

............................STT

Template Predicted Secondary structure 






............................



Template SS confidence 








































































   3......10.........20...... ...30.........40.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions