Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence49.03%DateThu Jan 5 12:22:54 GMT 2012
Rank103Aligned Residues32
% Identity25%Templatec2hkoA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:lysine-specific histone demethylase 1; PDBTitle: crystal structure of lsd1
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   14.....20.........30.........40.........50.........60.........70...
Predicted Secondary structure 

























Query SS confidence 



























































Query Sequence  TTRQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNA
Query Conservation       
 


   

           
            

   


  
  

     
Alig confidence 










............................




















Template Conservation     
 





............................




 

  
   
  



Template Sequence  KKTGKVIIIGS. . . . . . . . . . . . . . . . . . . . . . . . . . . . GVSGLAAARQLQSFGMDVTLL
Template Known Secondary structure  S
S


............................BTT
Template Predicted Secondary structure 





............................



Template SS confidence 



























































   276...280...... ...290.........300.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions