Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence68.99%DateThu Jan 5 12:22:54 GMT 2012
Rank74Aligned Residues36
% Identity36%Templatec2e1mA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:l-glutamate oxidase; PDBTitle: crystal structure of l-glutamate oxidase from streptomyces sp. x-119-6
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   10.........20.........30.........40.........50.........60.........70...
Predicted Secondary structure 

























Query SS confidence 































































Query Sequence  LPELTTRQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNA
Query Conservation           
 


   

           
            

   


  
  

     
Alig confidence 














............................




















Template Conservation         







............................







  
   
  
 

Template Sequence  LNPPGPPKRILIVGA. . . . . . . . . . . . . . . . . . . . . . . . . . . . GIAGLVAGDLLTRAGHDVTIL
Template Known Secondary structure  SSS

S



............................BTS
Template Predicted Secondary structure 









............................




Template SS confidence 































































   52.......60...... ...70.........80.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions