Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence30.74%DateThu Jan 5 12:22:54 GMT 2012
Rank144Aligned Residues33
% Identity30%Templatec2b9yA_
PDB info PDB header:isomeraseChain: A: PDB Molecule:putative aminooxidase; PDBTitle: crystal structure of cla-producing fatty acid isomerase2 from p. acnes
Resolution2.21 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   13......20.........30.........40.........50.........60........ .70...
Predicted Secondary structure 
























.
Query SS confidence 























































.




Query Sequence  LTTRQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGI. EAGNA
Query Conservation        
 


   

           
            

   


  
  

 .    
Alig confidence 











............................















.




Template Conservation        
 



............................
 


 

  
   
   
 
 
Template Sequence  ISKDSRIAIIGA. . . . . . . . . . . . . . . . . . . . . . . . . . . . GPAGLAAGMYLEQAGFHDYTIL
Template Known Secondary structure 

TT



............................STT


Template Predicted Secondary structure 







............................




Template SS confidence 





























































   3......10.... .....20.........30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions