Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence25.42%DateThu Jan 5 12:22:54 GMT 2012
Rank164Aligned Residues28
% Identity39%Templatec2aczA_
PDB info PDB header:oxidoreductase/electron transportChain: A: PDB Molecule:succinate dehydrogenase flavoprotein subunit; PDBTitle: complex ii (succinate dehydrogenase) from e. coli with atpenin a52 inhibitor co-crystallized at the ubiquinone binding site
Resolution3.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   18.20.........30.........40.........50.........60.........70...
Predicted Secondary structure 





















Query SS confidence 























































Query Sequence  SVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNA
Query Conservation   
 


   

           
            

   


  
  

     
Alig confidence 






............................




















Template Conservation 





 ............................
 


 

  

  
  
 

Template Sequence  DAVVIGA. . . . . . . . . . . . . . . . . . . . . . . . . . . . GGAGMRAALQISQSGQTCALL
Template Known Secondary structure  S


............................STT


Template Predicted Secondary structure 

............................



Template SS confidence 























































   910..... ....20.........30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions