Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence23.94%DateThu Jan 5 12:22:54 GMT 2012
Rank171Aligned Residues37
% Identity27%Templatec1zfnA_
PDB info PDB header:transferaseChain: A: PDB Molecule:adenylyltransferase thif; PDBTitle: structural analysis of escherichia coli thif
Resolution2.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8.10.........20.........30.........40.........50.........60.........70...
Predicted Secondary structure 

























Query SS confidence 

































































Query Sequence  TLLPELTTRQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNA
Query Conservation             
 


   

           
            

   


  
  

     
Alig confidence 








.






............................




















Template Conservation    
  
   . 




 ............................




 
   

  


 
 
Template Sequence  DGQQKLLDS. QVLIIGL. . . . . . . . . . . . . . . . . . . . . . . . . . . . GGLGTPAALYLAGAGVGTLVL
Template Known Secondary structure 
.

............................STTTT
S
Template Predicted Secondary structure 
.


............................



Template SS confidence 

































































   21........ 30...... ...40.........50.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions