Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence65.37%DateThu Jan 5 12:22:54 GMT 2012
Rank79Aligned Residues38
% Identity39%Templatec1yq4A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:succinate dehydrogenase flavoprotein subunit; PDBTitle: avian respiratory complex ii with 3-nitropropionate and ubiquinone
Resolution2.33 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   10.........20.........30.........40.........50.........60.........70.....
Predicted Secondary structure 

























Query SS confidence 

































































Query Sequence  LPELTTRQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNALP
Query Conservation           
 


   

           
            

   


  
  

     
  
Alig confidence 














............................






















Template Conservation   
  
 
 






............................
 


 

  


 
  
 



Template Sequence  YPVVDHEFDAVVVGA. . . . . . . . . . . . . . . . . . . . . . . . . . . . GGAGLRAAFGLSEAGFNTACVTK
Template Known Secondary structure  S

S

............................STT

S
Template Predicted Secondary structure 










............................




Template SS confidence 

































































   12.......20...... ...30.........40.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions