Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence36.91%DateThu Jan 5 12:22:54 GMT 2012
Rank130Aligned Residues33
% Identity30%Templatec1y56B_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:sarcosine oxidase; PDBTitle: crystal structure of l-proline dehydrogenase from p.horikoshii
Resolution2.86 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   13......20.........30.........40.........50.........60.........70...
Predicted Secondary structure 

























Query SS confidence 




























































Query Sequence  LTTRQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNA
Query Conservation        
 


   

           
            

   


  
  

     
Alig confidence 











............................




















Template Conservation   
   






............................

 


 
  
   
  
 

Template Sequence  LPEKSEIVVIGG. . . . . . . . . . . . . . . . . . . . . . . . . . . . GIVGVTIAHELAKRGEEVTVI
Template Known Secondary structure 

SB
S

............................STT

Template Predicted Secondary structure 





............................


Template SS confidence 




























































   2.......10... ......20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions