Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence43.06%DateThu Jan 5 12:22:54 GMT 2012
Rank116Aligned Residues33
% Identity33%Templatec1v0jB_
PDB info PDB header:isomeraseChain: B: PDB Molecule:udp-galactopyranose mutase; PDBTitle: udp-galactopyranose mutase from mycobacterium tuberculosis
Resolution2.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   13......20.........30.........40.........50.........60..... ....70...
Predicted Secondary structure 





















.



Query SS confidence 




















































.







Query Sequence  LTTRQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKR. LGIEAGNA
Query Conservation        
 


   

           
            

   


  
  .

     
Alig confidence 











............................












.







Template Conservation 
    






............................
 





  
    
  
 

Template Sequence  MTARFDLFVVGS. . . . . . . . . . . . . . . . . . . . . . . . . . . . GFFGLTIAERVATQLDKRVLVL
Template Known Secondary structure 


S
S

............................S


Template Predicted Secondary structure 







............................



Template SS confidence 





























































   4.....10..... ....20.........30.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions