Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence42.06%DateThu Jan 5 12:22:54 GMT 2012
Rank119Aligned Residues33
% Identity30%Templatec1tytA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:trypanothione reductase, oxidized form; PDBTitle: crystal and molecular structure of crithidia fasciculata2 trypanothione reductase at 2.6 angstroms resolution
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   13......20.........30.........40.........50.........60....... ..70...
Predicted Secondary structure 























.

Query SS confidence 






















































.





Query Sequence  LTTRQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLG. IEAGNA
Query Conservation        
 


   

           
            

   


  
  

.     
Alig confidence 











............................














.





Template Conservation 


 







............................
 


 

  

  
   
 

Template Sequence  MSRAYDLVVIGA. . . . . . . . . . . . . . . . . . . . . . . . . . . . GSGGLEAGWNAASLHKKRVAVI
Template Known Secondary structure 

SS

............................S


Template Predicted Secondary structure 





............................





Template SS confidence 





























































   1........10.. .......20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions