Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence41.30%DateThu Jan 5 12:22:54 GMT 2012
Rank121Aligned Residues33
% Identity21%Templatec1ryiB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:glycine oxidase; PDBTitle: structure of glycine oxidase with bound inhibitor glycolate
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   13......20.........30.........40.........50.........60.........70...
Predicted Secondary structure 

























Query SS confidence 




























































Query Sequence  LTTRQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNA
Query Conservation        
 


   

           
            

   


  
  

     
Alig confidence 











............................




















Template Conservation 
    

 



............................

 


 
  

  
  
 

Template Sequence  MKRHYEAVVIGG. . . . . . . . . . . . . . . . . . . . . . . . . . . . GIIGSAIAYYLAKENKNTALF
Template Known Secondary structure 

S

............................STT

Template Predicted Secondary structure 




............................


Template SS confidence 




























































   1........10.. .......20.........30...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions