Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence85.15%DateThu Jan 5 12:22:54 GMT 2012
Rank68Aligned Residues45
% Identity31%Templatec1qo8A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:flavocytochrome c3 fumarate reductase; PDBTitle: the structure of the open conformation of a flavocytochrome2 c3 fumarate reductase
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........60.........70...
Predicted Secondary structure 



























Query SS confidence 








































































Query Sequence  MSGARLHTLLPELTTRQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNA
Query Conservation                    
 


   

           
            

   


  
  

     
Alig confidence 























............................




















Template Conservation                
  






............................
 


 


 


 
  
 

Template Sequence  DQDKIQKAIAAGPSETTQVLVVGA. . . . . . . . . . . . . . . . . . . . . . . . . . . . GSAGFNASLAAKKAGANVILV
Template Known Secondary structure 
T

S

............................ST

Template Predicted Secondary structure 






............................



Template SS confidence 








































































   106...110.........120......... 130.........140.........150
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions