Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence78.02%DateThu Jan 5 12:22:54 GMT 2012
Rank72Aligned Residues41
% Identity27%Templatec1jrxA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:flavocytochrome c; PDBTitle: crystal structure of arg402ala mutant flavocytochrome c32 from shewanella frigidimarina
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10.........20.........30.........40.........50.........60.........70...
Predicted Secondary structure 

























Query SS confidence 




































































Query Sequence  RLHTLLPELTTRQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNA
Query Conservation                
 


   

           
            

   


  
  

     
Alig confidence 



















............................




















Template Conservation            
  






............................
 


 


 

  
  
 

Template Sequence  RQAALASAPHDTVDVVVVGS. . . . . . . . . . . . . . . . . . . . . . . . . . . . GGAGFSAAISATDSGAKVILI
Template Known Secondary structure  S

S
S

............................STT

Template Predicted Secondary structure 







............................



Template SS confidence 




































































   115....120.........130.... .....140.........150.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions