Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence21.30%DateThu Jan 5 12:22:54 GMT 2012
Rank184Aligned Residues48
% Identity31%Templatec1gqqA_
PDB info PDB header:cell wall biosynthesisChain: A: PDB Molecule:udp-n-acetylmuramate-l-alanine ligase; PDBTitle: murc - crystal structure of the apo-enzyme from haemophilus2 influenzae
Resolution3.1 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   17..20.........30.........40.........50...... ...60.........70.........80.........90.....
Predicted Secondary structure 


















.










Query SS confidence 







































.






































Query Sequence  QSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCA. LNIAVALKRLGIEAGNALPLGQGVWAEMIRNRMAKEGLI
Query Conservation    
 


   

           
            

  . 


  
  

     
  

 
  
  
   
   

 
Alig confidence 







............................



.














.....


















Template Conservation 
 


 
 ............................ 
 
 
 

  
   
  
 .....  
         
   

 
Template Sequence  QQIHFIGI. . . . . . . . . . . . . . . . . . . . . . . . . . . . GGAGMSGIAEILLNEGYQIS. . . . . GSDIADGVVTQRLAQAGAK
Template Known Secondary structure 
ST............................TSTTT
.....S

ST
Template Predicted Secondary structure 


............................






.....






Template SS confidence 















































































   1920...... ...30.........40...... ...50.........60.....
 
   96.
Predicted Secondary structure 
Query SS confidence 

Query Sequence  SL
Query Conservation    
Alig confidence 

Template Conservation    
Template Sequence  IY
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 

   66.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions