Return to main results Retrieve Phyre Job Id

Job DescriptionP76419
Confidence83.02%DateThu Jan 5 12:22:54 GMT 2012
Rank69Aligned Residues45
% Identity22%Templatec1d4cB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:flavocytochrome c fumarate reductase; PDBTitle: crystal structure of the uncomplexed form of the2 flavocytochrome c fumarate reductase of shewanella3 putrefaciens strain mr-1
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........60.........70...
Predicted Secondary structure 



























Query SS confidence 








































































Query Sequence  MSGARLHTLLPELTTRQSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNA
Query Conservation                    
 


   

           
            

   


  
  

     
Alig confidence 























............................




















Template Conservation                   






............................
 


 

  


 
  



Template Sequence  DKAAQDKAIAAGVKETTDVVIIGS. . . . . . . . . . . . . . . . . . . . . . . . . . . . GGAGLAAAVSARDAGAKVILL
Template Known Secondary structure  SS



S

............................ST

Template Predicted Secondary structure 









............................




Template SS confidence 








































































   110.........120.........130... ......140.........150....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions