Return to main results Retrieve Phyre Job Id

Job DescriptionP75734
Confidence3.53%DateThu Jan 5 12:13:34 GMT 2012
Rank54Aligned Residues27
% Identity22%Templatec2eg9B_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:adp-ribosyl cyclase 1; PDBTitle: crystal structure of the truncated extracellular domain of2 mouse cd38
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   73......80.........90.........100.....
Predicted Secondary structure 





Query SS confidence 
































Query Sequence  RVLDYQQCLRATQTGNDQAVKADCDKVWQEIRS
Query Conservation   







 

 

      


 
 





Alig confidence 








......

















Template Conservation 

  
    ...... 
  
  

  

  
  
Template Sequence  RCLIYTQIL. . . . . . RPEMRDQNCQEILSTFKG
Template Known Secondary structure  TT......SGGGTTS
T
Template Predicted Secondary structure  ......







Template SS confidence 
































   6970....... ..80.........90.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions