Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABK2
Confidence3.48%DateThu Jan 5 11:15:40 GMT 2012
Rank21Aligned Residues60
% Identity18%Templatec2bbjB_
PDB info PDB header:metal transport/membrane proteinChain: B: PDB Molecule:divalent cation transport-related protein; PDBTitle: crystal structure of the cora mg2+ transporter
Resolution3.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   196...200.........210.........220.........230.........240.........250.........260.........270.....
Predicted Secondary structure 
















Query SS confidence 















































































Query Sequence  LHLRTRATAQVAALVTLVCFALAGVWVMYGIDGYVVKSTMDHYAASNPLNKEVVREAGAWLVNFNNTPILWAIPALGVVL
Query Conservation 
  


  
        
      
                           
                      
    
Alig confidence 





























...............................


















Template Conservation   
   
  

 




 





 





...............................


   

   
  
    
Template Sequence  VSNKTNEVMKVLTIIATIFMPLTFIAGIYG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . MNFWKWGYPVVLAVMGVIA
Template Known Secondary structure  TTTTTTTT...............................






SSS
Template Predicted Secondary structure 
...............................





Template SS confidence 















































































   283......290.........300.........310.. .......320.........330.
 
   276...280......
Predicted Secondary structure 

Query SS confidence 










Query Sequence  PLLTILTARMD
Query Conservation             
Alig confidence 










Template Conservation        




Template Sequence  VIMVVYFKKKK
Template Known Secondary structure  TTS

Template Predicted Secondary structure 

Template SS confidence 










   339340.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions