Return to main results Retrieve Phyre Job Id

Job DescriptionP08322
Confidence3.24%DateThu Jan 5 11:01:05 GMT 2012
Rank99Aligned Residues33
% Identity15%Templatec3nolA_
PDB info PDB header:transferaseChain: A: PDB Molecule:glutamine cyclotransferase; PDBTitle: crystal structure of zymomonas mobilis glutaminyl cyclase (trigonal2 form)
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   128.130.........140.........150.........160.........170.
Predicted Secondary structure 











Query SS confidence 











































Query Sequence  FFQTSVRVWPQYGRVEIRGVLKTWIGDSKPFTDIKHYILILKRE
Query Conservation 
    
 
      
 
 
 
 
 

        
 
 
     
Alig confidence 


















...........













Template Conservation      


 



  
 


...........        
     
Template Sequence  DVLNGIAWDKEHHRLFVTG. . . . . . . . . . . KLWPKVFEITLTQR
Template Known Secondary structure 

TTTT...........TT
S
Template Predicted Secondary structure 





...........





Template SS confidence 











































   225....230.........240... ......250.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions