Return to main results Retrieve Phyre Job Id

Job DescriptionP0A825
Confidence54.60%DateThu Jan 5 11:06:42 GMT 2012
Rank353Aligned Residues28
% Identity14%Templatec2ya0A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:putative alkaline amylopullulanase; PDBTitle: catalytic module of the multi-modular glycogen-degrading2 pneumococcal virulence factor spua
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   173...... 180.........190.........200
Predicted Secondary structure 






........






Query SS confidence 






. . . . . . . .




















Query Sequence  GFSAYSG. . . . . . . . VVDWAKMREIADSIGAYLFVD
Query Conservation    
  
 ........  

  
  

   
  



Alig confidence 






........




















Template Conservation      




  
     


 

  

  

 



Template Sequence  LTGMYSSDPKNPEKRIAEFKNLINEIHKRGMGAILD
Template Known Secondary structure  B
STTSS
TTSTTTT
Template Predicted Secondary structure 

















Template SS confidence 



































   220.........230.........240.........250.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions