Return to main results Retrieve Phyre Job Id

Job DescriptionQ57154
Confidence48.44%DateThu Jan 5 12:37:14 GMT 2012
Rank29Aligned Residues43
% Identity35%Templatec3ltiA_
PDB info PDB header:transferaseChain: A: PDB Molecule:dna-directed rna polymerase subunit beta; PDBTitle: crystal structure of the escherichia coli rna polymerase beta subunit2 beta2-betai4 domains
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   253......260.........270.........280.........290.........300.........310.........320..
Predicted Secondary structure 






























Query SS confidence 





































































Query Sequence  GYLDYTEIQRGRTKFFCIHYRRPRLKAPNDESKENPLPPSPAEKVSPEMAEKLALLEKLGITLDDLEKLF
Query Conservation 


     
        
  
 
 
                                  
       
  
Alig confidence 










.





.







.........................

















Template Conservation 





 
 

. 
 


.

 




.........................
 







   

  
Template Sequence  SWLDFEFDPKD. NLFVRI. DRRRKLPA. . . . . . . . . . . . . . . . . . . . . . . . . TIILRALNYTTEQILDLF
Template Known Secondary structure 


TTS.
.TT


T.........................TT

Template Predicted Secondary structure 




..






.........................




Template SS confidence 





































































   182.......190.. ...... .200...... ...210.........220....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions