Return to main results Retrieve Phyre Job Id

Job DescriptionP0AFJ7
Confidence2.63%DateThu Jan 5 11:26:31 GMT 2012
Rank69Aligned Residues25
% Identity24%Templated1j8yf2
SCOP infoP-loop containing nucleoside triphosphate hydrolases P-loop containing nucleoside triphosphate hydrolases Nitrogenase iron protein-like
Resolution2.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   413......420.........430.........440.....
Predicted Secondary structure 











Query SS confidence 
































Query Sequence  IGKKGMTYAQGMSAQMTAAVSIGLASYTGMPVS
Query Conservation 


  


 






 

  




 





Alig confidence 


..






......














Template Conservation   

..



   ......
  
        

 
Template Sequence  ITK. . MDGTAKG. . . . . . GGALSAVAATGATIK
Template Known Secondary structure 
..TTS
S
......TTT

Template Predicted Secondary structure  ..



......


Template SS confidence 
































   246.. .250..... ....260.........270
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions