Return to main results Retrieve Phyre Job Id

Job DescriptionP0AFJ7
Confidence2.14%DateThu Jan 5 11:26:31 GMT 2012
Rank98Aligned Residues32
% Identity13%Templatec3kydB_
PDB info PDB header:ligaseChain: B: PDB Molecule:sumo-activating enzyme subunit 2; PDBTitle: human sumo e1~sumo1-amp tetrahedral intermediate mimic
Resolution2.61 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   425....430.........440... ......450......
Predicted Secondary structure 


.................

Query SS confidence 


















. . . . . . . . . . . . . . . . .












Query Sequence  SAQMTAAVSIGLASYTGMP. . . . . . . . . . . . . . . . . VSTTHVLSSSVAG
Query Conservation 



 

  




 



.................




  





Alig confidence 


















.................












Template Conservation     

 
 




  
 
        
 


 














  
Template Sequence  AMDFVTSAANLRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIV
Template Known Secondary structure  TT




T


Template Predicted Secondary structure 














Template SS confidence 
















































   351........360.........370.........380.........390.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions